SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010821 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010821
Domain Number 1 Region: 181-562
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.1e-105
Family Ankyrin repeat 0.000000744
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000116
Family Protein kinases, catalytic subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010821   Gene: ENSMLUG00000011881   Transcript: ENSMLUT00000011877
Sequence length 564
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429884:1204382:1209761:-1 gene:ENSMLUG00000011881 transcript:ENSMLUT00000011877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDHLHIRISDFGLSKWMEQSTRTQYIERSALRGTLSYMPPEMFLQSNMAPGPKYDVYRTS
HTKEIILSSRRSGTLVSLTQLEVGVARRGVSEDLGDESYPWRTVLGRRKEWRTAWTRTAL
LIHPVSLVLPPQVSEEVSQELTDSARSQAESGGDLKRVLQLSDSESLVPSDEELRIYENK
VTPLHFLVAQGSVEQVRLLLAHEVDVDCQTACGYTPLLIATQDQQPELCALLLDHGADAN
LADEDGWTPLHFTAQNGDDRTARLLLDRGARVDAQEHEGWTPFHLAAQNNFENVARLLVS
RQADPNLREAEGKTPLHVAAYFGHVTLVKLLTGQGAELDAQQRNLRTPLHLAVERGKVRA
IQHLLKSGAAPDALDRDGYSPLHTAAARGRYLICKMLLRYGASLELPTQQGWTPLHLAAY
KGHLEIIHLLAESHADLGAPGSMNWTPLHLAARHGEEEVVAVLLQCGADPNAAEQSGWTP
LHLAVQRGSFLSVTHLLEHHADVHAHSKGGWTPAHLAALKGNMAILKVLVRAGAQLDVQA
GEGCTPLQLALRSQKQSVAAFLEG
Download sequence
Identical sequences G1PJA1
ENSMLUP00000010821 ENSMLUP00000010821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]