SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010822 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010822
Domain Number 1 Region: 35-113
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-17
Family SH3-domain 0.00077
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010822
Domain Number - Region: 678-730
Classification Level Classification E-value
Superfamily SH3-domain 0.0948
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010822   Gene: ENSMLUG00000011869   Transcript: ENSMLUT00000011878
Sequence length 955
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:29193238:29207158:1 gene:ENSMLUG00000011869 transcript:ENSMLUT00000011878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQRIRAANASGLPRCKSEGTLIDLSEGFSETSFNDVKVPSPSALLGDNPTPFGNAKEV
IAIKDYCPNNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
DSGMIDNLPDSPEEVAKELDLLGGWTDDKKGSGKTYSNNPFWNGVQTNPFLNGKVPGMPS
VDELAPRSSVDLLLFDTGTSSFTESSSATTNSTGNILDELPATNQLHAEGPVKRDNPFFR
SKRSYSLSELSVLQAKSDAPDSSGYFTGLKSPAPEQFQSREDFRAAWLSHRKLARSCHDL
DLLGQNPGWGQTQAVETNIVCKLDSSGGSVQLPDTGISIHVPEGHVAQGETQQISMKALL
DPPLELNSDRCCTVSPVLEVKLSTLEVKTVIVLEMKVSAEVKNDIFSKSTVGLQCLRSDL
KEGPYVPIPLNYSYGDTVQVHLDNLEPCMYLAIVAHGPNILYPSTVWDFISKKVTVGLYG
PKHIHPSFKTVVTIFGHDCAPKTLLVTEVTRQAPSPAPVTLQLWGKHHFVLSRPQDLQVC
MFSNMTNYEVRAGEQAKVVRGFQMKLGKVSRLIFPIACQNPSELSDFTLRVQVKDDQEAI
LTQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIILSPFAATTKYPTFQDRPVSSLKFGK
LLKTVVRQSKNHYLLEYKKGDAIALLSEEKIRLKGQLWTKEWYIGYHQGKVGLVHAKNVL
VVGKARPSLLAGPELSTSVLLEQILRPCKFLTYIYASVRTLLMENISSWRSFADALGYGN
LPLTFFCRAELDSEPERVASVLEKLKEDCNNAENKDRKSFQKELMMALLKMDCQGLVVRL
IAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGD
SYRDVIQELHTGLDRMKNPITKRWKHLTGTLILVNTLDILRAAAFSPADQDDFVI
Download sequence
Identical sequences G1PJA2
ENSMLUP00000010822 ENSMLUP00000010822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]