SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010844 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010844
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.062
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010844
Domain Number - Region: 289-413
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 178-268
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0615
Family Oxygen-evolving enhancer protein 3, 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010844   Gene: ENSMLUG00000011899   Transcript: ENSMLUT00000011902
Sequence length 508
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429852:3623766:3648858:1 gene:ENSMLUG00000011899 transcript:ENSMLUT00000011902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTSKSNSVSPSPSLEQADSDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLL
YYSESEKKSFETNKHFNIHPKGVIPLGGCLVEAKEEPSMPYAMKISHQDFHGNILLAAES
EFEQAQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELRMEQEQIKRELELTARCLKGVEQEKKELRHFT
ESLQQTLEELSIEKKKTLEMLEENENQLETLANQSEQPSPSGGLHSNLRQIEGKMQQLLE
EKLLAEKRMKENEERSRALEEEREFYSSQSQALQNSLQELTAQKQQAEQELKAEVKVRMD
LERRLREAEAALRSLEQGLNSKVRNKEKEERMRADVSHLKRFFEECIRNAELEAKMPVIM
KNSVYIHKAATRRIKSCRFHRRRSTTSWNDMKPSQSFMTSQLEANNIEELKEVAKRLSRD
QRFRESIYHIMVTQPGPSSALPLPRGGK
Download sequence
Identical sequences G1PJC2
XP_006091081.1.53796 ENSMLUP00000010844 ENSMLUP00000010844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]