SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010845 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010845
Domain Number 1 Region: 355-481
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-23
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 2 Region: 206-315
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010845
Domain Number - Region: 507-525,672-723
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.006
Family Di-heme elbow motif 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010845   Gene: ENSMLUG00000011905   Transcript: ENSMLUT00000011903
Sequence length 759
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:11253900:11393103:-1 gene:ENSMLUG00000011905 transcript:ENSMLUT00000011903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALEVDDISPALEVTEDFFSTFDSKLEKAVQQAEVYGVQEVPELVGHEVLSNITDNGAI
RSVASLGEGGMLWDHCQTRFLETKVQNVFPTKEQFMVQKGTAPDNLSWMEQKEASTFNFF
NICQRRRDRPRSVNDLLDETTTFKPGHARSRSDVTQVDWRVSLKTTPLQQQPQQPSLQGP
PFTRPSFLSPSPNKIEDAQGNTEHKQAFPNILKKGYLEIRKDHDSYWQSCYAELSPYHLC
FYSRDSSGNQSLSATYPLSHFQSVSVLGNLEARLVDTVLYDNSQLQLKAESPWEALDWGQ
KLWEVVHAAVPGSVGRQDELANSPGPGYHFDCTQGHCLQKPSELLARSPVAGGPRQYQDV
LKSGTLYRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQIDNLDDCD
SCFQVIFPQDVLRLRAETRQRAQEWMEALKTAANAARSSEQNLQVTLRNKAQDPMGGHEL
RKSKRQSVTTSFLSILTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCSSC
HVDDSFLIPARVVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVV
RLRQRLKSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFLGK
VIKFASSHVYSCSLCSQKGFICEICNNGEILYPFEDISTSRCGSCGAVFHSECKEKSVPC
PRCVRRELQKKQKSFWRRLNVDESLEEACSMFELSYPNT
Download sequence
Identical sequences G1PJC3
ENSMLUP00000010845 ENSMLUP00000010845 XP_006082515.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]