SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010863 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010863
Domain Number 1 Region: 506-670
Classification Level Classification E-value
Superfamily Sec7 domain 4.06e-52
Family Sec7 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 706-842
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-24
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010863   Gene: ENSMLUG00000011914   Transcript: ENSMLUT00000011924
Sequence length 983
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430221:392897:402973:1 gene:ENSMLUG00000011914 transcript:ENSMLUT00000011924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLSEHPEPLEFLNVCLSDNLQPHPGVQPRETSSRPDPPGPLQELTWASDPSESTGRQDAP
AGGSRAEPEGLGSGSSQGGPQQNPSSSTQVVFWAGILQAQMCVLDLEEELEKTEGLRAEL
RSCIPTAPVDLPPFPSSPAAPLDPGPPASPPSGEDSSRPEGESQTQVSPGEGTPDSSPEW
GAEEESLFFDNPLFLESPCSDTSAPRERFSWGHPDSCADEDDDGRPESPQNLEPPLLLGR
VPWGLGDEPDSGDSVSESSGHTTPPFPMRHLQTTLLLLGRTITEPILSDHRAHPIGSQIP
SYHITEHILSDHRAHPIRSQSPSYQITEPILWDHRSHPIGSQSSSCLYSVCPALLGVSER
QDLVRSYQPTWSPFLGERALISEVLMLGLSRWGGRLAFHGTRERQAGRRPAFATPKPVWQ
AGRRPAFATPKPVWLPLLASSKHLPWSWKLELEGVGGAGVLRAPPRPDPEPMCAHPRESE
DTLPESPVPQGKSPEEGQGPQAADKLANGVRTDKRAWDLASRLYHLEGFRKSEVAVHLRK
NNDFSRAVAQEYLSFFQFGGQSLDRALRSFLQALVLSGETQERERVLFQFSRRFHHCNPG
LFSSVDSVHTLTCAIMLLNTDLHGQNIGKSMSCQEFISNLNGLQDGGNFPKELLKALYWS
IRSEKLEWAVDEEDAARPEKARSSPLGGKMSSPFLQPALDPTGPTYKQGILARKMHHDVD
GKKTPWGKRGWKMLHTLLRGMVLYFLKGEDHSPEGESLVGQMVDEPVGVHHSLATPATHY
TKKPHVFQLRTADWRLYLFQAPTAKEMSSWIARINLAAATHSAPPFPAAVGSQRRFVRPI
LPVGPAQSSLEEQHRSHENCLDAASDDLLDLQRNLPERRGRSRELEEYRLRKEYLEHEKT
RYEMYVQLLMTRLHCPSDDLDLWEEQLGREAAGPQESKPSLKKSHSSPSLHQDEAPTTAK
VKRNISERRTYRKIIPKRNRHQL
Download sequence
Identical sequences G1PJE0
ENSMLUP00000010863 ENSMLUP00000010863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]