SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010870 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010870
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.8e-41
Family Cofilin-like 0.0032
Further Details:      
 
Domain Number 2 Region: 369-422
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000084
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010870   Gene: ENSMLUG00000011929   Transcript: ENSMLUT00000011932
Sequence length 423
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430680:59380:69034:1 gene:ENSMLUG00000011929 transcript:ENSMLUT00000011932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANLSRNGPALQEAYARVVAEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEVVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGVCANHVSTMASFLKGAHVTINARAE
EDVEPECIMQKVARASGANYTFHRESSRFQDMGPQAPVGSVYQKTNAVSEIKRFGKDSFW
AKAEEEEEQRRAQEKQRAEQERQQLEQERRERELREAALREQRYQEQGQEARQSCPPSRK
SEQQEVVSRSREEQEPGQQSPRQMFMQKERAVSTASTSSPQPGKLRSPFLQRQLPQPESP
LGGERAHAASRPSAGVCEQPAPRAPECLVQAEEEALYEEPPEQETLYEEPPTGEQQDMGS
VRVDHYPGLSGKGLCARALYDYQAADKTEISFDPKNLITASKRENEPDGHFGMFPANYVE
LIE
Download sequence
Identical sequences G1PJE6
ENSMLUP00000010870 ENSMLUP00000010870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]