SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010897 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010897
Domain Number 1 Region: 926-1008
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-20
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010897   Gene: ENSMLUG00000011932   Transcript: ENSMLUT00000011962
Sequence length 1009
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429899:3062054:3164807:1 gene:ENSMLUG00000011932 transcript:ENSMLUT00000011962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVPIYEDVKGETEEEKAEEEENEEDKVFFKPVIEDLSMELARKCTELISDIHYREEYKK
SKDKCTFVTDTPMLNHVKNIGAFISEAKYKGTTKADLSNSLYKQMPATIDSVFAREVTQL
QSKIAYKQKHDAARGLSDYTHMKEPPAMEVNKHQSNISYRKDMQDTHMYNAELNRPDIKM
ATQISKIVSNAEYKKGQGVMNKEPAVIGRLDFEHAVEASKLSSQIKYKEKFDNEMKDKKH
HYNPLESVSFKQSQLATELASNVKYKKDIQNMHDPVSGLPTLFLDHALKVSKMLSRREYR
KMFEENKGMYHFDSDAAEHLHHKGNAILQSQVKYREEYEKNKGKSMLEFVETPSYQASKE
AQKMQSERVYREDFEREIKGRSSLDLDKTPEFLHVKYITNLLKEKEYRKDLENEIKGKGM
DLNSEVLDIQRAKRASEIASEKEYKKDLESEIKGKGMQVGIDTLEIQHAKKASEIASEKD
YKRDLETEIKGKGMQVSTDTLDIQRAKKASGMASQIEYKKDLETEIKGKGMQVSMDVLDM
LRAKRASEIYSQKKYKDEAEKMLSNYSPVADTPEIQRIKTTQQNISSVFYKKEVGAGTAV
KDSPEIERVKKNQQNISSVKYKEGIKHATAISDPSELKRVKENQKNISNLQYKEQSYRAT
PVSMTPEIERVRRNQEQLSTVKYKGEIKQATAISDPPELKRVKENQRNISNVYYKGQLGR
ATPLSVTPEMERVKKNQENISSVKYTQDHKQMKGRPSLILDTPGLRHVKEAQNHISMVKY
HEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVDLKVWR
TDPGSIFDIDPLEDNIQSRSLHMLSEKASQYRRQRSRSHSSSTFGTVLGDDKSEISEIYP
SFSCSSEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSLSSMRSMQHSPNLRTYRAMYDY
SAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGKTGMLPANYIEFVN
Download sequence
Identical sequences G1PJG9
ENSMLUP00000010897 ENSMLUP00000010897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]