SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010926 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010926
Domain Number 1 Region: 263-359
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-24
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 2 Region: 10-98
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000308
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010926   Gene: ENSMLUG00000011993   Transcript: ENSMLUT00000011996
Sequence length 2193
Comment pep:novel scaffold:Myoluc2.0:GL430383:138606:232603:1 gene:ENSMLUG00000011993 transcript:ENSMLUT00000011996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLLFLQPTTLPQGTINMNQCTDVVDGEGRTGQKFSLCILTPEKEHFIRAETKEIISGWLE
MLMVYPRTNKQNQKKKRKVEPPTPQEPGPAKMAVTSSSSIPSAEKVPTTKSTLWQEEMRA
KDQPEESSLSPAQSPSQSQPPATSALREPGLEGEDEESAMSSDRMDCGRKVRVESGYFSL
EKTKQDLKAEEHPLPQPVSPPSPSTPNNRRSQVIEKFEALDIEKAEHMETNLPAGHSPSS
DTRQGRSEKRAFPRKRPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRDSVAEEAA
DLDGEIDLSTCYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTSA
PDVTSSLPEEKSRISSSFETCPRPSEKPEVEPREPDPEPKRSRARERRREGRSKTFDWAE
FRPLQQALAQERAGAGLPSSLSEAGPGELERERARRREERRKRFGMLDTVDGPATDDTSL
RMEVDRSPGLPVAPDLKTQNVHVEIEQRWHQVETTPLREEKQVPIAPLHLSSEDRSDRLS
THELTSLLEKELEQSQKEASDLLEQNRLLQDQLRVALGREQSAREGYVLQTEVATSPSGA
WQRLHRVNQDLQRELEVQCRRQGLTTQQTQALKCSYGEAEDAVRHHEAEIRSLQARLSTA
AAELTFKEQALAQLKGDLKLEKDKAREHLEEWQHSKAMLSGQLQASEQKLKSAEALLLEK
TRELRDLETQQALQRDRQKEVQRLQERIADLSQQLSASEQAQRLMEEKLQRNYELLLESC
EKEKQALLQNLKEVEDKASAYEDQLQDHEQQVEALQREKLSARSEGSQAVRQLEEQLQVK
EASLQTLAQHVQSLRDERDLVRQRFQELTERVALSDGDVAELQQKLQGREADYQSLEHAY
QRVASQLQGMHTLLREREEELRHIKDVHEKVLEKKDQALNEALVKMVALGSSLEETEMKL
QTKEEILRKFTKASSEEVEEPQSSLGEAEDGFALSGLQLPASGTSPGCPHLRLEDEDPGA
ALKEKHGHSSPTREVSMMPPKSEVPEKEGHSRNTAKCEQCVPGINRQRIRFSTIQCQKYT
HPDGSEKTWTSSTSSDTSQDRSPSEESMSSEATLSSVPATSDSDTYLSIIHSLETKLYIT
EEKLKDVTVKLESQQGQSQEALLTLHHQWAGTEARLREQLRASLLQVGTLASQLEQEKQA
RAKIIENHVGKLGNFQVKNTQALACLENCREQLRSLPRSGQEEAPGAGAGPLASVESVLV
SAIQALRHWPAPADSGSQTPLEEESFLERGKETLQQPSPQPELTEQEQLKLLADQIALEA
SLINHIADSLKNTTSDISHVLDEVSQSGKLPLESGSAVCLGAPADTWAKKVLVDGEFWSQ
VESLSKHLGTVGGEAASASGGGQQSIPPALVPTLADATWVRAELSFAVQSVRESFQRRLQ
SIRETLRGTQAALRQHKHALEEILGAYRTPDFERVMQQVAEALKLPAGTAEGVQAPWDLS
PLREELSHQDTAGFQEPFHFSDQNSGAIVGIQEELALQLKDKARLLGEISASLTSLPPVG
SIRDCQKLLQVSRNLSCNTYLGGLGQYSSLLVKDAIIQAQVCYAACKIRLEYEKELQCYK
ESWQSRGASCQEHEQAVGALREEYKELLRKQKSEYLEVIAIIQRENAELKAQVTQLDQQQ
RYLEEVESKHNENMFALQGRYEEEIRCVVEQLNRAENTLQAEHSRVLSQLDASVRDRQDM
ERHHVEQMQTLEDKFQLKVKELQTIHEEELRTLQEHYSQNLQCLQETLCHYQGQPPEALL
ASSPHQPPSSIWPAGQPRDGLQVATGEADSMVGLRERIQELEAQMDIMREELEHKDLEGD
TATLREKYQKDFENLKATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEET
AATISAIEAMKNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSVQRELEVLSE
QYSQKCLENAHLAQALEAERQALRQCQRENQELNAHNQELNNRLAAEIARLRTLLTGDAG
GEAAGLPLTQGKDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIY
KELSIVRAKADCDISRLKEQLKTATEALGDKSPESTPVAGYDIMKSKSNPDFLKKDRSSV
SRQLRNIRSKSLKEGLTVQERLKLFESRDLKKD
Download sequence
Identical sequences G1PJJ4
ENSMLUP00000010926 ENSMLUP00000010926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]