SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010935 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010935
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily EF-hand 1.1e-33
Family Calmodulin-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010935   Gene: ENSMLUG00000012005   Transcript: ENSMLUT00000012005
Sequence length 175
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430680:114428:116134:-1 gene:ENSMLUG00000012005 transcript:ENSMLUT00000012005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASRKAGTRGKAAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLRET
YSQLGKVSVPDEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSQAEVEQMFALTPVDLAGDIDYKSLCYIITHGDEKEE
Download sequence
Identical sequences G1PJK2
ENSMLUP00000010935 ENSMLUP00000010935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]