SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010936 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010936
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-33
Family Ras-binding domain, RBD 0.002
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010936   Gene: ENSMLUG00000011999   Transcript: ENSMLUT00000012006
Sequence length 659
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430073:421279:472937:1 gene:ENSMLUG00000011999 transcript:ENSMLUT00000012006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESNDDIDQMFSNLLGEMDLLTQSLGVDTLPPPDPKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQGPYHQAPPEVSHFSGAASPGYGANVVATS
MSQCEDDLPPPPADPMLDLPLPPPPPEPLSQEEEEAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCSVDWCLYEIYPELQLERFFEDHENV
VEVLSDWTRDTENKVVFLKKEEKYAVFKNPQNFYLDNKGKKESKETNEKMNAKNKECLLE
ESFCGTSVIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDERTLNQWVTGIRIAKYG
KTLYDNYQRAVAKAGLASRWTNLGTGNAATPTPPSTGLTAGTAQANGQIPQAAHSVSAVP
EEAQRHVDTTKDKKPALGQPDPGTPKVHHRPKSSMPPPPPIRRSSDTSGSPVIPAKAKGT
GFPAPPDDFLPPPPPPPPLEDPELPPPPPDFNDSPPDFVPPPPPSFVGDAGSLPPPPPPP
PALAPESPRPPPIATKRPPIPPKRQENPGPPSAGAGGGGEQDFMSDLMKALQKKRGNLP
Download sequence
Identical sequences G1PJK3
XP_006100319.1.53796 ENSMLUP00000010936 ENSMLUP00000010936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]