SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010970 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010970
Domain Number 1 Region: 222-387,419-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-37
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Domain Number 2 Region: 484-677
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.94e-32
Family cAMP-binding domain 0.00072
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-21
Family Flavin-binding PAS domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010970
Domain Number - Region: 873-914
Classification Level Classification E-value
Superfamily BAS1536-like 0.0432
Family BAS1536-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010970   Gene: ENSMLUG00000012036   Transcript: ENSMLUT00000012042
Sequence length 1018
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:1576513:1593585:1 gene:ENSMLUG00000012036 transcript:ENSMLUT00000012042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTGSCRFLYGPETSEPALQRLHKALEGRQEHRTEICFYRKDGSGFRCLLDMMPIKNGM
GEVVLFLFSFKDITQSGGPGPGPSGSHGDSNHENSLGRRGASSRLRFARRQNRTVLRRLT
GHFGRRGQGSMKTNRNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAVWDGLILLATFYV
AVTVPYNVCFLGDDDTPIASRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVVSAPRSI
GLHYLATWFFVDLIAALPFDLLYIFNITVTSLVHLLKTVRLLRLLRLLQKVERYSQCSAV
VLTLLMSAFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNSSAGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDVEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLQDFIRLHRLPRPLKQRMLEYFQTTWAVNSGIDANQLLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRTLSLHIKTSFCAPGEYLLRCGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADTIEPGQEPGSGAGPSCVLKTSADVKALTYCGLQQLSSR
GLAEVLKLYPEYGAAFRAGLPRDLTFNLRQGSDTNGLGRFSRSPRSPGPSQPHSESLGSS
DKTLPSITEAEAESEPGGGPRPRRPLLLPNLSPARPRGSLVSLLGEELPPFSALVSSPSP
SLSPSLFPSSALVGRGHSPSSHGPPRGFAARKPPQLLIPPLGTFGTTDLSPRIVDGIEDS
GSTAEAPTFQFSRRPEHPRPRSQASPTGTRPSQELATEAEEMKEKVCRLNQEISCLNQEV
SQLSQELRHMMGLLQARLGPPGHPTVSARPSGPPCLQQRPPCISPCRSGAPSSIQDTTLA
EVHCPATVGTAEMGTAHPNLRPYVLSPYPSEPDPLGPSPVPEASLPTPSFRSRSDTFH
Download sequence
Identical sequences G1PJN3
ENSMLUP00000010970 ENSMLUP00000010970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]