SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010979 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010979
Domain Number 1 Region: 18-180
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000209
Family Rhomboid-like 0.0059
Further Details:      
 
Domain Number 2 Region: 304-359
Classification Level Classification E-value
Superfamily UBA-like 0.000000255
Family UBA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010979   Gene: ENSMLUG00000012043   Transcript: ENSMLUT00000012051
Sequence length 383
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430036:546913:549938:1 gene:ENSMLUG00000012043 transcript:ENSMLUT00000012051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDRGPPGLLSPALPLASSVLMLLMSCLWLVGAGPSLALAPELLLDPWQAHRLLTHALGH
TALPSLLLSLLLLPVLGWRQEYHLGTLRFLHASTLLALAAGLMAVLLAGLGVSAAAGGCG
YMPVHLAMLSGQGYHPRGLHGAVPPWLLPWLLLALTPLLTSEPPFLQLFCGLLAGLAYAA
GAFQWLEPSERRLRALQGFLCRVVGCWPLRLLPAPGSVAELPVTLPGVRLSTPGPPYAAS
SSLWSHSEGSGPLPPGLGPVQPNWEGSSEAGLAWPGPSFPPGSPLWAALDEQMLQEGIQA
SLLEGPAQVPRSPLWLPKSSVSSLRLQQLERMGFPMEQAVVALAATGRVEGAVSLLVSGE
VGAEALVTQGRGGLAHPEGPGPP
Download sequence
Identical sequences G1PJP2
ENSMLUP00000010979 XP_006099353.1.53796 XP_006099354.1.53796 XP_006099355.1.53796 ENSMLUP00000010979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]