SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010988 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010988
Domain Number 1 Region: 182-305
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-26
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 83-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-23
Family Second domain of FERM 0.0012
Further Details:      
 
Domain Number 3 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.53e-17
Family First domain of FERM 0.0015
Further Details:      
 
Domain Number 4 Region: 380-429
Classification Level Classification E-value
Superfamily RING/U-box 0.0000105
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010988   Gene: ENSMLUG00000012057   Transcript: ENSMLUT00000012061
Sequence length 444
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429862:1427827:1448053:-1 gene:ENSMLUG00000012057 transcript:ENSMLUT00000012061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDVLMEVEVEAKANGEDCPYQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRNR
ISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLQCSSEQAVELSA
LLAQTKFGDYNQNTAKYSYEELCAKELSSAALNSIVAKHKELEGTSQASAEYQVLQIVST
MENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFTPINRIAYPVVQMATQSGKNVYLTV
TKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLFL
NENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVPRSEHSPPSSPLKASESSMNCS
SCEGLSCQQTRVLQEKLRKLKEAMLCMLCCEEEINSAFCPCGHTVCCEGCAAQLQSCPVC
RSLVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences G1PJQ1
ENSMLUP00000010988 ENSMLUP00000010988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]