SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010990 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000010990
Domain Number - Region: 45-174
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.045
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010990   Gene: ENSMLUG00000012060   Transcript: ENSMLUT00000012064
Sequence length 201
Comment pep:novel scaffold:Myoluc2.0:GL429822:3119047:3124192:1 gene:ENSMLUG00000012060 transcript:ENSMLUT00000012064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPPDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFS
MGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALA
KVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLEN
DEKLSEVEEAQETSMDADPKP
Download sequence
Identical sequences G1PJQ3
ENSMLUP00000010990 ENSMLUP00000010990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]