SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011016 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011016
Domain Number 1 Region: 20-252
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.88e-69
Family BAR domain 0.00041
Further Details:      
 
Domain Number 2 Region: 244-276,306-363
Classification Level Classification E-value
Superfamily SH3-domain 4.5e-18
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011016   Gene: ENSMLUG00000012086   Transcript: ENSMLUT00000012091
Sequence length 364
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429893:2778416:2807030:-1 gene:ENSMLUG00000012086 transcript:ENSMLUT00000012091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMMDFNVKKFAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEVLLQPNPNARIEEFVYEKLDRKAPSRVNNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTAALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRASSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQ
CYQYMLDLQKQLGSFPSSYHSNNNQTSVVPVPSASSNVIGSSAMTSSGLVMTSPSNLIDL
KEGSGSRKARVLYDYDAANSSELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITYL
ELLN
Download sequence
Identical sequences G1PJS6
ENSMLUP00000011016 XP_006093974.1.53796 ENSMLUP00000011016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]