SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011059 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011059
Domain Number 1 Region: 732-913
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 
Domain Number 2 Region: 888-1009
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 26-73,191-277
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-28
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011059
Domain Number - Region: 273-334
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0549
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011059   Gene: ENSMLUG00000012131   Transcript: ENSMLUT00000012138
Sequence length 1139
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429791:10949379:11025226:1 gene:ENSMLUG00000012131 transcript:ENSMLUT00000012138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSHVPDVISSIRQLSKAAMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLID
DCIEKFSLHEQQRLRGQGEHGPDAANHRAVFEVEGPSSPADILLEEDDDIPDTHPALPAV
ASQPALASSRGCFPERILEDSVFDDPQEFRSRCSSVTGLQRKVPENSHKPQPRRRHASAP
SHVQPSDSEKNRTMLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICR
ESPEPGLSQYICYVFQCASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHK
LCERIEGLYPPRAKLVIQRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCE
AKQKTHIHIGEGPSVRLFQIATIPENAASSGRFKLDVLKNKAKRSLTSSLENIFSRGANR
MRGRLGSMDSFERANSLASEKDYSPGDSPPGTPPASPQASGWQTFPEEDSDSPQFRRRAH
TFSHPPSITKRKLNLQDGRAHGMRSPLLRQSSSEQCSILPSARRMHKESNSSSSLPSLHT
SFSAPSFTAPSFLKGFYQNSGRLSPQYENEIRTRQDTASESSDGEGRKRTSSTCSNDSLN
VGGTPVTPRRISWRQRIFLRVASPMNKSPSAMQQQDGLDRNELLPLSPLAPTMEEEPVVM
FMSGGDDPEKAEERKKSEELRSLWRKAIHQQILLLRMEKENQKLEASRDELHSRKIKLDY
EEVGVCQKEILITWDKKLLNCRGKTKCDMEDIHTSLKEGVPKSRRGEIWQFLAVQYRLRH
RLPNKQQPPDTSYKELLKQLTTQQHAILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYS
LLDKEVGYCQGISFVAGVLLLHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLS
RLLHDYHRELYNHLEENEISPSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKV
ALSLLNSQETLIMECESFENIVEFLKSTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEY
HVLQDELQESSYSCEDSEPVEKLERANNQLKRQNMDLLEKLQTAHAKIQTLESNLENLLT
RETKMKSLVRTLEQEKMAYQKTVEQIRKLLPADALADCEALLRDLTCNPNHKAKAGGKA
Download sequence
Identical sequences G1PJW7
ENSMLUP00000011059 ENSMLUP00000011059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]