SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011116 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011116
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011116   Gene: ENSMLUG00000012204   Transcript: ENSMLUT00000012203
Sequence length 249
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430170:698290:699039:-1 gene:ENSMLUG00000012204 transcript:ENSMLUT00000012203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANTRRINIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMASCQPTRSDSYSQSLKSPLNDVSD
DDDDDDSSD
Download sequence
Identical sequences G1PK15 L5MHS6
ENSMLUP00000011116 XP_005879305.1.60319 XP_006102245.1.53796 XP_006753253.1.95426 XP_014405733.1.60319 XP_015416600.1.95426 XP_019487558.1.44202 XP_019487559.1.44202 XP_019487560.1.44202 ENSMLUP00000011116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]