SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011157 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011157
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000119
Family TAP-C domain-like 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011157
Domain Number - Region: 51-177
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.017
Family Tex N-terminal region-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011157   Gene: ENSMLUG00000012251   Transcript: ENSMLUT00000012249
Sequence length 258
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:11564117:11597538:1 gene:ENSMLUG00000012251 transcript:ENSMLUT00000012249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLD
RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQE
FMDGMTELVCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLID
DFVEFARPQIAGTKSTTV
Download sequence
Identical sequences G1PK56
ENSMLUP00000011157 ENSMLUP00000011157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]