SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011172 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011172
Domain Number 1 Region: 31-146
Classification Level Classification E-value
Superfamily PX domain 1.96e-32
Family PX domain 0.00044
Further Details:      
 
Domain Number 2 Region: 184-371
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000488
Family BAR domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011172   Gene: ENSMLUG00000012263   Transcript: ENSMLUT00000012269
Sequence length 387
Comment pep:novel scaffold:Myoluc2.0:GL430311:4193:31105:-1 gene:ENSMLUG00000012263 transcript:ENSMLUT00000012269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMNSLSPTMPTSPLSMINQVKFEDEPDLKDLFITVDDPESHVTTIETFITYRVATQTSR
GEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFVVKGMVERFSDDFIETRRRA
LNKFLNRIADHPTLTFSEDFKVFLTAQAGELSSHKKQGPGLLSRMGQTVRAVALSMRGVR
SRPEEFTEMNDFIETFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHALWSESEEDLAD
TLGGVASCLDRCCQATERRLCGLSEALLPVVHEYVLYSEMLMGVMRRRDHIQAELESKAE
ALTYKKADTDLLTEEVGKLEDKVECANTALRADWERWKQNMRNDIKSAFADTAERNIHYY
EQCLATWESFLTAQSDLYAKEPPDDKP
Download sequence
Identical sequences G1PK69
ENSMLUP00000011172 ENSMLUP00000011172 XP_006104182.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]