SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011174 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011174
Domain Number 1 Region: 220-537
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-91
Family p120GAP domain-like 0.0000266
Further Details:      
 
Domain Number 2 Region: 94-215
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000327
Family Synaptotagmin-like (S variant) 0.074
Further Details:      
 
Domain Number 3 Region: 42-91
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000134
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011174   Gene: ENSMLUG00000012258   Transcript: ENSMLUT00000012271
Sequence length 1089
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429854:4052633:4077660:1 gene:ENSMLUG00000012258 transcript:ENSMLUT00000012271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSHLMPRVKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSK
CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
LYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
VAGRQFVEKWYPVMTPNPKGGKGPGPMIRIKARYQTISILPMEMYKEFAEHITNHYLGLC
AALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK
AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAGDLPEHQGNLKMCCELAFC
KIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQ
EYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
ISNTAGFEGYIDLGRELSSLHALLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTPGSGQ
LPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQ
PSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDALTTDGQMPAAQ
LVAGWPARAAPVSLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP
LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSSAAEELGRRPGELARRQMSLTEKG
GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPTLLSTLQYPRPSSGTLASASPDW
AGPGARLRQQSSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLG
PDPPHRDRLRSKEELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQAR
LEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIAS
LDAANARLMSALTQLKESSRLFCSSSACAPTQRARRAGVGRTTVPAQTLRETLSSPLPTQ
RRLFGELLC
Download sequence
Identical sequences G1PK71
ENSMLUP00000011174 ENSMLUP00000011174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]