SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011245 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011245
Domain Number 1 Region: 882-1166
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-71
Family Protein kinases, catalytic subunit 0.00000618
Further Details:      
 
Domain Number 2 Region: 576-879
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-45
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 3 Region: 463-554,583-609
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000392
Family SH2 domain 0.0074
Further Details:      
 
Domain Number 4 Region: 375-439
Classification Level Classification E-value
Superfamily PH domain-like 0.000000148
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 147-271
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000314
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011245   Gene: ENSMLUG00000012345   Transcript: ENSMLUT00000012352
Sequence length 1187
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430306:133194:150810:1 gene:ENSMLUG00000012345 transcript:ENSMLUT00000012352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVKSMPLCHGGATAGGSKPDGDETQLTAITGGLKVFLHWAGPGNREPWVTFSEATLTAEE
VCIHIAHKVGITPPCFNLFALFDAQAQVWLPPNHIFEVSRDTNLTLHFRMRFYFRNWHGT
NPQEPAVYRCRPPGAEASSEQAEQGVQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEE
IHHFKNESLGMAFLHLCHLALCRGVPLEKVAKKTSFKDCIPRSFRQQIRQYNAFTRLRLR
IIFRRFLHAFQPDSLSQHVVMVKYLATLERLAPRFGTERVPVCHLELLAQAEGEPCYIQD
SAQAPGDPKPKSAVEPPTHEVLVTGTGGIQWRPIQAEGPGGGDGGSSRNPHAGLSGKKAK
AQQRGGQPVDRPREAPWAYFCDFRDITHVVLRERHVSIHCQDKRLELTLPSPASALSLVS
LVDGYFRLTADSNHYLCHEVAPPRLVMSIQDGVHGPLLDPFVLAKMQREDGLYLIHWSTS
HFNRLILTVAQQDQAPGTPRLRLWKFPIELCEGTFRLQSWDRSFPSVRELRAALQGCSLR
AGDHCFSLRHCCLPQPGEISNLIITRGPQASARSLNLSQLSFHRVCQDDLTQLSHLGQGT
RTNVYEGLLRVGGGGPEEDEAYVGDPTLPGGGHGQELRVVLKVLDTSHHDIALAFYETAS
LMSQVSHVHLTFVHGVCVHGSQNIMVTEYVEHGPLDVWLRRERGRVPVAWKVAVAQQLAS
ALSYLEDKRLAHGNVCGRNILLARLGLAEGTSPFIKLSDPGMGLGALSREERVERIPWMA
PECLFGGANSLSTAADKWGFGATLLEICFDGEAPLQDRSPAEKEYFYQKQHQLPEPSCPE
LATLTSQCLTYEPAQRPSFRTILRDLTHLQPQNLVEILCVNPTSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNEGTGEMVAVKALKADCGPQLRTSWRREIDILRTLYHEHIV
KYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHRVGLAQLLLFAQQICEGMAYLHTQHYV
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHDYYRVREDGDSPVFWYAPECLKECKFYY
ASDVWSFGVTMYELLTYCDSSQSPPSKFIELIGLTQGQMTVLRLTELLERGERLPRPEKC
PHEIYVLMKNCWEAEASFRPTFQNLIPILKTAHEKYQGQAPSVFSVG
Download sequence
Identical sequences G1PKC8
ENSMLUP00000011245 ENSMLUP00000011245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]