SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011271 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011271
Domain Number 1 Region: 482-827
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.83e-114
Family Rap/Ran-GAP 0.0000005
Further Details:      
 
Domain Number 2 Region: 951-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000559
Family PDZ domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011271
Domain Number - Region: 863-931
Classification Level Classification E-value
Superfamily PH domain-like 0.0182
Family Third domain of FERM 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011271   Gene: ENSMLUG00000012365   Transcript: ENSMLUT00000012379
Sequence length 1706
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429952:790787:904513:1 gene:ENSMLUG00000012365 transcript:ENSMLUT00000012379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYRPIPNDGMDLAASCGVRGANVLPGPQTGDYAPVGFWVQNGMPQPVGESPATAITRP
SPTTPTVPKMGVRARVADWPPKREALREQNNPSPSQDTDGTKTTKVAHSMRSIQNGEPAT
NTPASSGSRAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSELTLSECDLEDMGEA
KGGRLMGALPLFREYGSTSSIDVQGMPEQSFFDILNEFRNEQPEAQGSQNLTELLQAHSG
PHLPWSISGAKGDLRHEQPTSDNLLPLQPGKEKERARKKPVRGLGSGDTVDSSIFRKLRS
NKPEGDTGRSPGEAEEGRSPPEASRPWVCQKSFAHFDVQSMLFDLHEAAANRVSSAQRRN
TTTGASAASAMESLTVSRAHGLGGLDPAFTSMEDLNYKENLEQDLGDDNSNDLLLSCPHF
RNEIGGECERNVSFSRASAASLGGSECRLAEPSPSTYRTNASISVLEVPKEQQRTQSRPQ
QYSIEHVDLGARYYQDYFVGKEHANYFGVDDKLGPVAVSIKREKLEDHKDHGPQYQYRII
FRTRELITLRGSILEDATPTATKHGTGRGLPLKDALEYVIPELNIHCLRLALNTPKVTEQ
LLKLDEQGLCRKHKVGILYCRAGQSSEEEMYNNEDAGPAFEEFLSLLGEKVCLKGFTKYA
AQLDVKTDSTGTHSLYTTYQDYEIMFHVSTLLPYTPNNRQQLLRKRHIGNDIVTIIFQEP
GALPFTPKNIRSHFQHVFIIIRAHNPCTDNVGYSMAVTRSKDAPPFGPPIPSGTTFRKSD
VFRDFLLAKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCISNTPIDSTGKFNLISLT
SKKKEKTKARAGAEQHSSGAIAWRVAAQDYGQGMEIDCILGISNEFVVLLDLHTKEVVFN
CYCGDVIGWTPDSSTLKIFYGRGDHIFLRTTEGSVEDIRDIVQRLKVMTNGWETVDMTLR
RNGLGQLGFHVKYDGTVAEVEDYGFAWQAGLRQGSRLVEICKVAVVTLTHDQMIDLLRTS
VTVKVVIIPPFEDGTPRRGWPETYDMNTSEPKPEQDSMPSGGRPPYRSNAPWQWSGPASH
NSLPASKWATPATPGHPQSLSRPPKQTPMVPFRESQPLHSKRPVSFPETPYTASPAGVDK
APPYRQPSGSFSTPGSATYARYKPSPERYVAAPHPLLSFDPHFGHDGTSSGDSSSGGLTS
QESTMERQKPEPLWHVPAQARLSALAGTSGSKHASRQDAAGKDSPNRHSKGEPQYSSHSS
SNTLSSNASSSHSDDRWFDPLDPLEPEQDPLSKGGSSDSGIDTTLYTSSPSCMSLAKAPR
PAKPHKSPGSIGLCGGGRESTGHSHHADRRREVSPAPVVAAQSQAYRPKLYNSGSSTPTG
LTGGSRNPPRQTSDMNSRAGYPAQVYKTTSAETPQPSQLAQSSSFQLSASVPKSFFSKQP
VGNKHPTGWKRTDEPPPRPLPFTDPKKQVDTNTKNVFGQPRLRASLRDLRSPRKNYKSTI
EDDLKKLIIMDNLAPDQERDAGPGGQAGICSTLEDLTSPLTEPSLSHPPSETLFLSPPHF
RVSSAPKGGRGYHTYPPPYLCSPHPATISASELSLADGRDRPLRRLDPGMMPLPDTAAGL
EWSSLVNAAKAYEVQRAVSLFSLNDPALSPDMPPAHSPVHSHLSLERGPPTPRTTPTMSE
EPPLDLTGKVYQLEVMLKQLHTDLQK
Download sequence
Identical sequences G1PKF0
ENSMLUP00000011271 ENSMLUP00000011271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]