SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011272 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000011272
Domain Number - Region: 528-613
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0523
Family FCH domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011272   Gene: ENSMLUG00000012374   Transcript: ENSMLUT00000012380
Sequence length 706
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430218:80424:110006:1 gene:ENSMLUG00000012374 transcript:ENSMLUT00000012380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFSESHKTVFVVDHCPYMAESCRQHVEFDMLVKNRTQGIIPLAPISKSLWTCSVESSM
EYCRIMYDIFPFRKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALAAVGPPNPRADPECC
SILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQ
ETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRSKKELSPVLTSEVHSVRAG
RHLATKLNILVQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDTH
LGGSSREGSFKETITLKWCTPRTNNIELHYCTGAYRISPVDVNSRPSSCLTNFLLNGRSV
LLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRITDFGE
FMRENRLTPFLDPRYKIDGSLEIPLERAKDQLEKHTRYWPMIISQTTIFNMQAVVPLASV
IVKESLTEEDVLNCQKTIYNLVDMERKNDPLPISTVGTRGKGPKRDEQYRIMWNELETLV
RAHINNSEKHQRVLECLMACRSKPPEEEERKKRGRKREDKEDKSEKAVKDYEQEKTWQDL
ERLKSILERGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPPVEKSKGPVSLLTLWSNR
INTANSRKHQEFAGRLNSVNNRAELYQHLKEENGMETTENGKASRQ
Download sequence
Identical sequences G1PKF1
XP_005871888.1.60319 XP_006103048.1.53796 ENSMLUP00000011272 ENSMLUP00000011272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]