SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011310 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011310
Domain Number 1 Region: 155-298
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-33
Family cAMP-binding domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 21-152
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-33
Family cAMP-binding domain 0.000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011310   Gene: ENSMLUG00000012418   Transcript: ENSMLUT00000012421
Sequence length 304
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:8731382:8756192:-1 gene:ENSMLUG00000012418 transcript:ENSMLUT00000012421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCAEAYNPDEEEDDTESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKL
VKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAA
TITATSPGALWGLDRVTFRRIIVKNNAKKRKMYENFIESLPFLKSLEVSERLKVVDVIGT
KVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKAEVEENGAVEIARCSRGQYFGELA
LVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNITTYEEQLVALFGTNMDIV
EPTA
Download sequence
Identical sequences G1PKI2
ENSMLUP00000011310 ENSMLUP00000011310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]