SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011343 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011343
Domain Number 1 Region: 351-644
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-78
Family Ankyrin repeat 0.0000156
Further Details:      
 
Domain Number 2 Region: 3-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-76
Family Protein kinases, catalytic subunit 0.000000000475
Further Details:      
 
Domain Number 3 Region: 657-691,767-875
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000111
Family G proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011343   Gene: ENSMLUG00000012450   Transcript: ENSMLUT00000012458
Sequence length 1108
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430919:2:73024:-1 gene:ENSMLUG00000012450 transcript:ENSMLUT00000012458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVGILKEIQHPNVIT
LHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHF
DLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEA
DMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEYFSNTSALAKDFIRRLLVK
DPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRL
SRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGLQHLLGSLSNYDVNQPNKH
GTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWASRHGHVDTLKFLHENKCPL
DVKDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEETPLHCAAWHGYYSVAKALC
EAGCNVNIKNREGETPLLTASARGYHDIVECLAEHGGDLNASDKDGHIALHLAVRRCQME
VIQTLLSQGSFVNFQDRHGNTPLHVACKDGNVPIVVALCEAGCDPDISNKYGRTPLHLAA
NNGILDVVRYLCLTGANVEALTSDGKTAEDLARSEQHEHVAGLLARLRKDTHRSLFIQQL
RPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRRPRLSSTNSTRFPPSPLAS
KPAVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPSHHPHCSADDQSTKAIDI
QNAYLNGVGDFSVWEFSGNPVYFCSYDYFAANDPTSIHVIVFSLEEPYEIQLNQVVFWLS
FLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNVPRPAGGEFGYDKDTALLKEIRNRF
GNDLHISDKLFVLDAGASGSKDMKVLRNHLQEIRSQIVAIAKEFKSDLNIMIQVWHNVHF
THTPSTTEVCPPMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEEDLR
GIAQQLHSAGEINIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDI
QRLVPDSDVEELLQILDAMDICARDLSS
Download sequence
Identical sequences G1PKL0
ENSMLUP00000011343 ENSMLUP00000011343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]