SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011377 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011377
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.5e-23
Family PB1 domain 0.00000501
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000141
Family ZZ domain 0.012
Further Details:      
 
Domain Number 3 Region: 944-981
Classification Level Classification E-value
Superfamily UBA-like 0.00000000217
Family UBA domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011377   Gene: ENSMLUG00000012487   Transcript: ENSMLUT00000012500
Sequence length 992
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:891133:912358:-1 gene:ENSMLUG00000012487 transcript:ENSMLUT00000012500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQVTLNVSFKNETQSFLVSDPENTTWADVEAMVKVSFDLNTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGYRVVDEAPPPVLAEKPPVSRTGKKPLAHYSSLMRV
LGSDMKTPEEPAPQQFPLAPSDADQPQDRPPDWFTSYLETFREQVVKETVEKLEQKLHEK
LVLQNPSLGSCPSEVSMPISEETLFLPENQFNWHISCSSCQRRIFGVRYQCSLCPSYNIC
EDCESGPYVHDSNHVLLKLRRPVVGSSESFSHSRFSTPRLPAALEQARLQKQVDKNFLKA
EKQRLRAEKKQRKAEVKELKKQLKLRRKIHLWNSIHGLQSPKCPLGRPESLLQSNTLMLP
LQPCAPVMPTLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSTDTKLKFMWGNLT
MASTEKKDVLVPCLKAGHVGIVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDP
LCSTESSDNIEKSLINSSKTGDLTCQQEETFLLAKEEIQLGATEQTEGTGTYIPQKTKNV
ASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDMTPCMSPLPHDSPLIEK
PGLGQIQEESEGAGLKALSDSTASVKRRAENITSVEEAEDDLSGTQFVCETVIRSLTLDA
APDHNPPCRQKSLHNFPRAELQRHATEEQQLVLPGFCSEEFSLKFASPEEGPLGDEREEM
VHISEEEAIVEEEEEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALS
QPGLERGAEGEPGIEAGQEPVEAGETPPGGETQPQGYSINDILMTSQTLDTVPLTPEVVG
PPPRLPRRSPPCAQHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRH
HHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIVSEDQTAALMAHLFEMGFCDRQL
NLRLLKKHNYNILQVVTELLQVNNNDWYSHRY
Download sequence
Identical sequences G1PKN8
ENSMLUP00000011377 ENSMLUP00000011377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]