SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011388 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011388
Domain Number 1 Region: 313-680
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.79e-135
Family Mammalian PLC 0.0000000313
Further Details:      
 
Domain Number 2 Region: 912-966,1006-1158
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 6.54e-59
Family C-terminal domain of PLC-beta 0.0013
Further Details:      
 
Domain Number 3 Region: 141-312
Classification Level Classification E-value
Superfamily EF-hand 5.75e-55
Family EF-hand modules in multidomain proteins 0.00043
Further Details:      
 
Domain Number 4 Region: 13-140
Classification Level Classification E-value
Superfamily PH domain-like 3.11e-36
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 5 Region: 702-817
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-27
Family PLC-like (P variant) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011388   Gene: ENSMLUG00000012488   Transcript: ENSMLUT00000012513
Sequence length 1173
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429809:530669:644513:1 gene:ENSMLUG00000012488 transcript:ENSMLUT00000012513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVLPQTFTWWSEPSFLEQGQVFLDYEKTESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPD
VTKQWVDGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEQKQLEALKSM
MEAGESAAPVSILEDDNEEEIESVDQEEEAHPEYKFGSELDDLGHKEVVANSVKKGLVTV
EDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVGLG
YLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQLNQ
GKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGTYV
EVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNRLI
GQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKKFL
SITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKTNVTPQSSSELRPTTTAALG
SGMEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQVD
KIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQHTK
EWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQAK
ISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQLE
HLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV
Download sequence
Identical sequences G1PKP8
ENSMLUP00000011388 ENSMLUP00000011388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]