SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011422 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011422
Domain Number 1 Region: 235-420
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.2e-49
Family Nucleotide and nucleoside kinases 0.0000000263
Further Details:      
 
Domain Number 2 Region: 109-178,217-234
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000109
Family SH3-domain 0.0000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011422   Gene: ENSMLUG00000012550   Transcript: ENSMLUT00000012553
Sequence length 606
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430096:257632:271259:-1 gene:ENSMLUG00000012550 transcript:ENSMLUT00000012553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDSDVSLEEDREALRKEAEP
QALAQLEKAKVRKKGGAVLSYSPACASLPAFPGQDGHVGKKDSQNGDVKYNNDWWIGRLV
KEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLSSSKSGDNSSSSLGDVVTGTRRPTPPASA
FELDPLELEDEEAELGEPGGSAKTSVSSVTTPSPHGKRISFFKKTEHVPPYDVVPSMRPI
ILVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIER
SNTRSSLAEVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVL
QRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKAT
HPPSSTPPNPLLNRTMATAALAASPAPVSNLQGPYLASGDQSLDRATGEHASVHEYPGEL
GQPPGLYPSSHPPGRVGTVRALSRQDTFDANASGNRNSTYTEPGDSCVDMETDPSEGPGL
GDPAGAGTPPARQGSWEDEENDYEEELTDNRNRGRNKARYCAEGGAPVLGRNKNELEGWG
RGVYIR
Download sequence
Identical sequences G1PKS4
ENSMLUP00000011422 ENSMLUP00000011422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]