SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011432 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011432
Domain Number 1 Region: 286-393
Classification Level Classification E-value
Superfamily SH3-domain 1.73e-23
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 2 Region: 96-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000016
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011432   Gene: ENSMLUG00000012559   Transcript: ENSMLUT00000012564
Sequence length 417
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430096:286950:298728:-1 gene:ENSMLUG00000012559 transcript:ENSMLUT00000012564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEMSEKESEPDDAATHTAPGTASVLHETKLQRFKRSLSLKTILRSKSVENFFLRSGSEP
KCPTEVLLTPPTPLPPSSPPRAPTDRGLPTPAPSPCPVPRPLASLKPVRLHSFQEHVFKR
ANPCELCHQFIVGNSKQGLRCKTCKVSVHLWCSEEISHQQCPVKTSSSFRRNFSSPLLVH
EPPPACSTSRESPPTGASGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSEREELT
EDGESSIRSSEEGPGDNACLPPLASAVFTAPAESEGSGPEEKSPGQQPPKHPLRKDVGPM
YSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGEN
VWRCCQPFSGNKEQGYLSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPADALTEI
Download sequence
Identical sequences G1PKT1
ENSMLUP00000011432 ENSMLUP00000011432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]