SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011453 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011453
Domain Number 1 Region: 855-1221
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.56e-77
Family Ankyrin repeat 0.0000133
Further Details:      
 
Domain Number 2 Region: 1240-1373
Classification Level Classification E-value
Superfamily TPR-like 1.87e-20
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 
Domain Number 3 Region: 312-394,493-594
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000136
Family G proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011453   Gene: ENSMLUG00000012581   Transcript: ENSMLUT00000012586
Sequence length 1986
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429866:398943:611572:-1 gene:ENSMLUG00000012581 transcript:ENSMLUT00000012586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTGGKSSRKNRSSDGGSEEPPDRRQSSVDSRQSRSGQGGISTESDCAFEPDYAVPPLP
VSEGDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYNMEVEDENQTSAITQR
ISPCSTLTSSTASPPASSPCSTLPPVSTNATAKDCNYGAVTSPTSTLESRDSGIIATLTS
YSENVERTKYVGESSKELGSGGNLKPWQSQKASMDSCLYRVDENMTASTYSLNKIPERNL
ETVLSQSVQSIPLYLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQSMGGVRT
QQDLRVRFAPYRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNASVNQGVV
IVGNIGFGKTAIISRLVALSCHGTRMRQIASDSPHASPKHVDANRELPLTQPPSAHSSIT
SGSCPGTPEMRRRQEEAMRRLASQVVAYHYCQADNAYTCLVPEFVHNVAALLCRSPQLAA
YREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEA
EFHKPDYGDTIVSFLSKMIGKFPSWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAID
QDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSYLYLKLTFDLIEKG
YLVLKSSSYKVVPVSLSEVYLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTDEHIFQAI
NAGSIEGTLEWEDFQQRMENLSMFLIKRRDMTRMFVHPSFREWLIWREEGEKTKFLCDPR
SGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLWISYSTEG
LSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEF
GANVDVSSESGLTPLGYAAAAGYLSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVV
KFLIQCDWTMASQQQGVFKKSQAIQQALIAAASMGYTEIVSYLLDLPEKDEEEVERAQIN
SFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLL
THGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASIALMDKEGLTALSWACLKGHLS
VVRSLVDNGAATDHADKNGRTPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGMRPLDRAV
GCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFYKKGKVKEAAQRY
QYALKKFPREGFGEDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSYEA
YYARARAKRSSSRQFAAALEDLNEAIKLCPNNREIQRLLMRVEEECRQMQQQQQQQQPPP
QPPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPIIQSPP
SSPAHRDSAYISSSPLGSHQVFDFRSSSSVGSPTRQSYQSTSPALSPTHQNSHYRPSPPH
TSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQYRASPPAESMSVYRAQSGSPVRY
QQETNVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSSAVHS
STVISTGAYGQVAHSMASKYQSSQGDLGVSQSRLVYQGSIGGIVGDGRPVQHVQASLSAG
AICQHGGLTKEDLPQRPSSAYRGGMRYSQTPQIGRSQSASYYPVCHSKLDLERSSSQLGS
PDVSHLIRRPIGVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSASNLTPTFRPSSS
IQQMEIPLKPAYDRSCDELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQ
NRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDYYSPHG
MLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQDNLYRQLSRDSRQGQTSPIKPKRP
FVESNV
Download sequence
Identical sequences G1PKV0
ENSMLUP00000011453 ENSMLUP00000011453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]