SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011454 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011454
Domain Number 1 Region: 1532-1640
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 831-946
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 3 Region: 184-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-32
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 4 Region: 668-772
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 1884-1993
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 2222-2341
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.00095
Further Details:      
 
Domain Number 7 Region: 2056-2164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-31
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 8 Region: 8-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1350-1466
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 10 Region: 491-601
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2410-2514
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 12 Region: 1010-1119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1183-1292
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1700-1816
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 15 Region: 3117-3188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-20
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 16 Region: 2762-2830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-19
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 17 Region: 2819-2887
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2878-2944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 3001-3069
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-18
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 20 Region: 2703-2772
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 21 Region: 3059-3122
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.28e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 2169-2238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000132
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 23 Region: 428-499
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2576-2643
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 2933-2994
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000514
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 1997-2059
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000607
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 3298-3366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000876
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 3237-3293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 29 Region: 2514-2587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 952-1012
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000364
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 31 Region: 1470-1535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000702
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 1645-1710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000958
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 606-665
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 1823-1889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 1125-1187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000432
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 36 Region: 120-181
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000796
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 37 Region: 1296-1358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000132
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 3357-3415
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 39 Region: 777-844
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 40 Region: 2650-2714
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 41 Region: 3171-3232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 42 Region: 2340-2403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011454   Gene: ENSMLUG00000012541   Transcript: ENSMLUT00000012588
Sequence length 3654
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429784:2462415:3200761:-1 gene:ENSMLUG00000012541 transcript:ENSMLUT00000012588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGFIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYD
YLSLYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSS
CGNPGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANTVNTASWDFPVPICRA
EDACGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEI
EGSEPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSTLTLTTSTGEL
EEHNRTATGAIAVASTSADVTVSSVTAVTIHRLSEEQRVQVTNLRNAGLDPNTSKDGLSP
HQADTQSTRRRPRNAEQIERTNELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSILNEG
GIKTASNLCPDPGEPENGKRVGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWS
DHRPVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLE
IGYDTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYK
EIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPIC
IFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAV
KDGDSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDP
GIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGPIPRCGAPCGG
HFSAPSGLILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNL
LSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPV
HGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGT
ILSPGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLT
GSELPSTINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGNRIGFN
FGVGDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNY
PLNYENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRG
LTLSSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTI
IYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDN
NLRCMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKEISGSLIPEGIHST
LNIVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGREPGDTVVFQCDPG
YELQGEERITCIQVENRYFWQPSPPVCIVKAPCGGNLTGSSGFILSPNFPHPYPHSRDCD
WTITVNTDYVISLAFISFSIEPNYDFLYIHDGPDSNSPLIGSFQDSKLPERIESSSNTMH
LAFRSDGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYYCDAGYVLQG
YSTLTCIMGDDGRPGWNRALPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVP
KEFVVFGQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHSVGESLPLSSGNQITIRFTS
VGPITAKGFHFVYQAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLVLFECNPGYILHGSI
AIRCDTVPNSLAQWNDSLPTCIVPCGGILTKRKGTILSPGYPEPYDNNLNCVWKITVPEG
AGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDIS
VSAAGFHLEYTAIGLDSCPEPQTPSNGIKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMP
GPVRRWNYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWTVKLPVGFGVHLQFV
NFSTETIHDYLEVRSGTSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSDYSQNKQGFHI
VYQAYQLQSCPDPRPFRNGFVIGSDFTVGQTVSFECFPGYTLIGNSALTCLHGVSRNWNH
PLPRCEALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVRVPPGNGIYINFTVLQTEPVY
DFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRV
CQPPPPVPNAEILTEDDEFEIGDIIRYQCLPGFSLVGNAILTCRLGERLQMDGAPPVCQV
LCPANELRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNISMFVEFFQTEKEFDVLQV
YDGPNIQSPLLISLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRYIAFYCSTPES
PPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPACQAISCGI
PKAPTNGGILTTDYLVGTRVTYFCHDGYRLSSKELTTAVCQSDGTWSNHNKTPRCVVVTC
PSINSFTLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYC
QIISCGELPTPPNGNKIGTQTSYGSTAIFTCDAGFILVGSAVRECLSSGLWSGSETRCLA
GHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCVPVS
CGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCS
DPGIPPNSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGHWDKPLPECIMID
CGHPGVPPNAVLSGEKYTFGSTVHYSCTGKRSLLGHSSRTCQLNGHWSGSQPHCSGDATG
TCGDPGTPGHGSRQESNFRTQSSVHFACDTGYILHGSEERTCLANGSWTGRQPECKAVQC
GNPGTTANGKVFRIDGTTFSSSIIYSCIEGYILSGPSVRQCTANGTWSGTLPNCTIISCG
DPGIPANGLRYGDDYVVGHNVSYMCQPGYTMELNGSRIRTCTTNGTWSGVMPTCRAVTCA
TPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEGMQCSPPKFCGD
PGTPAQGKREGKSFIYQSEVAFSCNSPFILVGASTRICQADGTWSGSSPHCIEPTRTSCE
NPGVPRHGSQNSTFGFQVGSVLQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQ
PETPVHANVVGMDLPSHGYTLVYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCEAGSKIL
VKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYNFKGRKQPMTLTVTSFNASTGRVNATLS
NSNMELLLSGVYKSQEARLMLHIYLIKVPAHASVKKMKEESWAMDGFVSAEPDGATYVFQ
GFIQGKDYGQFGLQRLGLNMSEGLNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYK
QRTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences G1PKV1
ENSMLUP00000011454 ENSMLUP00000011454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]