SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011465 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000011465
Domain Number - Region: 17-109
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00774
Family Arfaptin, Rac-binding fragment 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011465   Gene: ENSMLUG00000012594   Transcript: ENSMLUT00000012599
Sequence length 388
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429929:1046824:1059194:1 gene:ENSMLUG00000012594 transcript:ENSMLUT00000012599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYCCYYSGAHQGHSVCDVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEK
VSQLKEEVRLQYEKLHQLLDEDLGQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLG
SLQLLFDKTEDVSFMKKKTSDAPSTAPRTQTCTGNSLSPPKIGHLNSKLFLNEVAKKEKQ
LRKMLEGPFSTPVPFLQSVPLYPCGVSSSGAEKRKHSMAFPEASFLETSSGPVGSQYGAA
GTASGEGQSGQPLGPCSSTQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGR
KILVCSVDNCYCSSVANHGGHQPYPRSGHFPWTVPSQEYSHPLPPAPSVPQSLPGLAVRD
WLDASQQPGHQDFYRVYGQPSTKHYVTS
Download sequence
Identical sequences G1PKW2
ENSMLUP00000011465 ENSMLUP00000011465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]