SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011487 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011487
Domain Number 1 Region: 229-404,434-495
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5e-44
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 15-109
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.03e-20
Family Flavin-binding PAS domain 0.000026
Further Details:      
 
Domain Number 3 Region: 624-681
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000236
Family cAMP-binding domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011487
Domain Number - Region: 499-545
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000745
Family cAMP-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011487   Gene: ENSMLUG00000012616   Transcript: ENSMLUT00000012621
Sequence length 971
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429866:303655:319277:-1 gene:ENSMLUG00000012616 transcript:ENSMLUT00000012621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPPPGRKFLIANAQMKTCIIYCNDGFCELFGYSRVEVMQRPCTCDFLTGPNTPRSAMTRL
AQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKSGSR
SLSQRLLSQSFLGSEGSHGRPGTQGPGTGRVKYRTISQIPQFTLNFVEFNLEKHRSGSTT
EIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQAPRIHRGTLLHYSPFKAVWDWL
ILLLVIYTAVFTPYSAAFLLSDQDESQRGDCSYTCSPLTVVDLIVDIMFVVDIVINFRTT
YVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFRTGSDETTTLIGLLKTARLLR
LVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYLEPKIGWLDSLGV
QLGKRYNVSDPASGPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSL
MYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNG
IDMNAVSPAALPGVGWATQLKSHSFFFFFFCPQLVSPCMRLCDLKFTSVHIPLLFKIFHG
SPWLTGQEWIPGGTCPGLHPSLSVTLVRKNDIFGEPVSLHAQPGKSSADVRALTYCDLHK
IQRADLLEVLDMYPAFADSFWSKLEVTFNLRDADGGLQSSPQQAPGNQDHQGFFLSDDQS
GEPAPKAGPRAPSQGYSLMGHGYQTSMETEPHSPGHAGAAPSLSLSDASGLWPELLQQVP
QRPRHSPPDPQGDPDCWSRELGSRLEQLQAQMNRLESRLSSDLSRILQLLQQPLPQGHTG
YILGASAHDLALFPVASATQSPGTRLPQGGLPPAQAPCCGDLDQREPKHRNASSRMPHRA
MATDKTLTLSSELEHPEGLLSSLASPLHPLEVQGLCGPRFPSLPEYLDSVPKQLEFPRHG
SDPGFAGSWSH
Download sequence
Identical sequences G1PKX8
ENSMLUP00000011487 ENSMLUP00000011487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]