SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011537 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011537
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-58
Family Sec7 domain 0.000000227
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 1.61e-33
Family Pleckstrin-homology domain (PH domain) 0.00000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011537   Gene: ENSMLUG00000012675   Transcript: ENSMLUT00000012678
Sequence length 394
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430708:2495:24265:-1 gene:ENSMLUG00000012675 transcript:ENSMLUT00000012678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGLLSPDPAELSSGETEELQRIKWHRKQLLDDIQKLKDEIEDVFAQIDCFEMTEESRMAQ
KEKELCIGRKKFNMDPVKSRAQQPRRELLAGSPEDPFLLSEQGAQVARRAAPPGLRAGDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMETFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDKPPFERFVSMNRGINAGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDSCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGKVVEGKHQSYRISASSA
EERDQWIEAIRASITRVPFYDLVSARKKKIASKH
Download sequence
Identical sequences L7N1N7
ENSMLUP00000011537 ENSMLUP00000011537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]