SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011587 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011587
Domain Number 1 Region: 150-277
Classification Level Classification E-value
Superfamily Second domain of FERM 8.52e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 279-383
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-24
Family Third domain of FERM 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011587
Domain Number - Region: 62-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00258
Family Ras-binding domain, RBD 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011587   Gene: ENSMLUG00000012730   Transcript: ENSMLUT00000012736
Sequence length 1613
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429816:6618811:6665389:-1 gene:ENSMLUG00000012730 transcript:ENSMLUT00000012736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCKESILLTVIQPYPSPKSAFISAAKKARLKSNPVKVRFSEEVIINGQVSETVKDNSLLF
MPNVLKVYLENGQTKSFRFDSSTSIKNILLRLKKKIPSDDLVSQNLAVALRVDTWGQIIL
CCGPSLLFQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYLYVQSCNDVVQERFG
PELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPSAVLQSMKEKNIKKA
LSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATLVQAEKRSEVTLLVG
PRYGISHVINTKTNLVALLADFSHVNRIEMFTEEESLVRVELHVLDVKPITLLMESSDAM
NLACLTAGYYRLLVDSRRSIFNMANKKNAGTQETGTENKGKLNILGPDWNCIPQMTTFIG
EGEQEAQITYIDSKQKTVEITDGTSCPKDHRHVYIANTYNPDELNPQLAQPGDAPCEADY
RSLAPRSLLTFSGPETLKKAQESPRGAKVSFIFGDLAMDEGSSPPALSYDRLLDENPELL
EKQANLYMRSANDMKNLDLAPDAENIPFGENSVYANIGDVKSFEAAPGIEEPLLHDICYA
ENTDDAEDEDEVSCEEDLMVGEMNQPALLNLSGSSDDIIDLTSLPPPEGDDNEDDFLLRS
LNMAIAAPPPGFRDSSDEEDSQSQAASFLDGKEPGGGLQNDEIPVSLIDAVPTSAEGTCD
KGLPKPAVSPLGALGALSVSEEQQTSNNSGVAILRAYSPESSSDSGNETNSSEMTESSEL
ATAQKQSETLSRMFLATPEGYHPLAEEQTEFSASKAPAAALPPKASHALAARPVPVTVTD
GPSKVVPSKQILHSDHMEMEPETMETKSVTDYFNKLHLGSLAYSCTSKRKSKLADGEGKA
PASGNAPGKKQPGAKSAEAEEDAKGKFGTVSSRDGPHLGFNLERTAFRKNSQRWYVTEGG
AADKGGLEAATGIFSTRFLGLGPRGGPKGRKERGSRVGKAPEVSGLGQRDHFLTDATCVP
SAKDLDHPGDADPSTCDRPSQPAREESVAHLCDYHLAKRMSSLQREGHFSLQSSQGSSVD
AGCGTGSSGSPCPTPREAPLLRSAGKGGPYASEERAPGLPHGAPFKESHPQPEGVCPRMT
VPALHTAINAEPLFGTLRDGCHRLPKIKETTALTESGKERRGGMPSVWSQYPEVDPILLP
SNIHSESKVPIPNQDPNDFSQASQAYGEAVSWQPLDLRGESHGTPPSQRALRRSSSVLSG
CVGLETFRERTKGTVSLKCPGVTEEAQEATSERRAELPLGKKLTKSFSQSSMHFSPDGKA
HKRSPVAHKDSKLYKTLPLRKLEGSNWRCRGPFSYCFLNRGQDEDEDEDEEEGAPTHRVS
CLFPLQMTKAMPEPTSPPLAVGIQKQEGELSRCPVLKVWAEDLSGPDDTDFSNLAFDARI
ARISALKQSTYAMPDGFLAAQNDANELLCLVRATKGKREESRPEAYDLTLSQYKQLLSIE
SRQLGSACRKMAMAEKSPEEMLVAMTSSFQVLCCLTEACMRLVKVVSSETQRQEIVVKID
EVVINYICLLKAAEAATGKTTGDPGVGLSTRPSTTMAALVSTLTRSLKMLLNK
Download sequence
Identical sequences G1PL70
ENSMLUP00000011587 ENSMLUP00000011587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]