SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011598 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011598
Domain Number 1 Region: 374-724
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-84
Family Protein kinases, catalytic subunit 0.00000181
Further Details:      
 
Domain Number 2 Region: 187-287
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 4.45e-44
Family MAST3 pre-PK domain-like 0.0000143
Further Details:      
 
Domain Number 3 Region: 960-1059
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-19
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011598   Gene: ENSMLUG00000012736   Transcript: ENSMLUT00000012748
Sequence length 1571
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430396:126082:155274:1 gene:ENSMLUG00000012736 transcript:ENSMLUT00000012748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSLWTALSNFSMPSFPGGSMFRRTKSCRTSNRKSLILTSTSPTLPRPHSPLPGHLGSS
PLDSPRNFSPNTPAHFSFASSRRADGRRWSLASLPSSGYGTNTPSSTVSSSCSSQERLHQ
LPYQPTVDELHFLSKHFGSTESITDEDGGRRSPAVRPRSRSLSPGRSPSSYDNEIVMMNH
VYKERFPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLI
TTVYFYELQENLEKLLQDAYERSESLEVAFVTQLVKRLLIIISRPARLLECLEFNPEEFY
HLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPDVVHLEEQDSGGSNTPEQDDLSEG
RGSSTKAKKPPGENDFDTIKLISNGAYGAVYLVRHRETRQRFAMKKINKQNLILRNQIQQ
AFVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVEMARMYF
AETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMSLTTNLYEGHIEKD
AREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQ
VISDDILWPEGDEALPTDAQLLISSLLQTNPLVRLGAGGAFEVKQHSFFRDLDWTGLLRQ
KAEFIPHLESEDDTSYFDTRSDRYHHVNSYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSM
EQLSQHEPKTPVAAAGGSKREPSAKGLEEKVAGKREGLGSLTLREKTWRGGSPEIKRFSA
SEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDETQLRRSARPTSDPPGSLDARVP
KEAAQGDGSASGGDSEATDQPRPGDLCPPSKDGDPSGPRATNDLVLRRARHQQLSGDPAV
EKRPSRTGGKVIKSASATALSVMIPAVDPHGSSPLASPMSPRSLSSNPSSRDSSPSRDYS
PAVSGLRSPITIQRSGKKYGFTLRAIRVYMGDSDVYSVHHIVWHVEEGGPAQEAGLCAGD
LITHVNGEPVHGMVHPEVVELILKSGNKVAVTTTPFENTSIRIGPARRSSYKAKMARRNR
RPSAKEGQESKKRSSLFRKITKQSNLLHTSRSLSSLNRSLSSSDSLPGSPTHGLPARSPT
HSYRSTPDSAYLGASSQSSSPASSTPNSPASSASHHIRPSTLHGLSPKLHRQYRSARCKS
AGNIPLSPLAHTPSPTQASPPPLPGHTVGSSHTTQSFPAKLHSSPPVVRPRPKSAEPPRS
PLLKRVQSAEKLGASLGADKKGALRKHSLEVGHPDFRKDFHGELALHSLAESDGETPPVE
GPGVPLQVAVRRLGRQESPLSLGVDPLPPQGTSRPTGASSKEESPGGAEACTQPRATTPA
GRTLERDASGTRHQSVQTVQTEDGLGGAARAVAKAALSPVQEHETGRRSSSGEVGTTLVP
IVVEPERPGAKVEVPRSLGSDSQGLPGSIPLVRPAPEVLRGPERRGLVVEERTTQSGPRS
KPTSPKLSPEAQTPPVAPTKNATSSTGPPAPPIPLLQATKPEVGLTSRYPAEAVPPSGLT
KRAPCPMPPGP
Download sequence
Identical sequences G1PL79
ENSMLUP00000011598 ENSMLUP00000011598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]