SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011617 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011617
Domain Number 1 Region: 842-1119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-72
Family Protein kinases, catalytic subunit 0.00000423
Further Details:      
 
Domain Number 2 Region: 522-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.97e-50
Family Protein kinases, catalytic subunit 0.0000562
Further Details:      
 
Domain Number 3 Region: 395-500,537-562
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-19
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 4 Region: 279-385
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000209
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 5 Region: 141-261
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000183
Family Second domain of FERM 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011617   Gene: ENSMLUG00000012756   Transcript: ENSMLUT00000012768
Sequence length 1132
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429897:3063705:3124718:1 gene:ENSMLUG00000012756 transcript:ENSMLUT00000012768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMACLTMTEMEGTCTPPMHQNGDIPGITDSVKQIDPVLQVYLYHSPGKTEGDYLKFSTG
EYVAEEICVAASKACGITPVYHSMFALMSETERIWYPPNYVFHIDESTRHNVLYRIRFYF
PYWYCSGSNRTYRHGISRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLDVYSSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVSIKQASQEGSNESRVTIHKQMVKNQEIELSSLKE
ALSFVSLIDGYYRLTADAHHYLCKEVASPVVLENIQSNCHGPISMDFAISKLKKAGNQTG
LYVLRCSPKEFNKYFLTFAVEHDNVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNCY
QMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNSVSDVPTSPTLQRHNNVNQMVFHKIR
NEDLVFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASMM
SQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWAM
HFLEEKNLIHGNVCAKNILLIREEDRKSGNPPFIKLSDPGISVTVLPKDILQERIPWVPP
ECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTELA
NLINNCMDYEPDFRPSFRAIIRDLNSLFTPADYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYLIMTECWNNNVNQRPSFRNLALRVDQIRDNIAG
Download sequence
Identical sequences G1PL96
ENSMLUP00000011617 ENSMLUP00000011617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]