SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011628 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011628
Domain Number 1 Region: 123-504
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.65e-146
Family Myotubularin-like phosphatases 0.0000000237
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-17
Family GRAM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011628   Gene: ENSMLUG00000012775   Transcript: ENSMLUT00000012780
Sequence length 622
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429865:1359619:1394208:1 gene:ENSMLUG00000012775 transcript:ENSMLUT00000012780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKRIYTTFEVEQVKLLDRFSTNNKSLTGTLYLTATHLLFIDSQQKETWILHHHIGSVEKL
ALTTSGCPLVIQCKNFRIVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDS
ERLRGWQLIDLAEEYKRMGVPNSNWQLSDANREYKICETYPRELYVPRIASKPIIVGSSK
FRSKGRFPVLSYYHQNKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPANRYMYVVDT
RPKLNAIANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVNDFY
SGLESSGWLRHIKAVMDAAIFLAKAIMVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYR
TVKGFMVLIEKDWISFGHKFSERCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQDFEFNE
AFLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLDDQKKYLNPLYSSNSQK
FAVLEPNTASFNFKFWRNMYHQFDRTLHPRESVCNIIMNMNEQNKQLEKDIKDLESKINK
RKNEQIDGVLTKELLHPVHPESPIIKTSLCFKEQTLLPVNDTLRTIEGSNPADNRYSEYA
EEFSKSEPAVVSLEYGVARMTC
Download sequence
Identical sequences G1PLA6
ENSMLUP00000011628 ENSMLUP00000011628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]