SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011631 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011631
Domain Number 1 Region: 245-310
Classification Level Classification E-value
Superfamily XPC-binding domain 1.7e-21
Family XPC-binding domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 20-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.3e-21
Family Ubiquitin-related 0.0000166
Further Details:      
 
Domain Number 3 Region: 319-378
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000136
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 169-220
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000244
Family UBA domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011631   Gene: ENSMLUG00000012783   Transcript: ENSMLUT00000012784
Sequence length 380
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430396:211864:217044:1 gene:ENSMLUG00000012783 transcript:ENSMLUT00000012784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VACCVRVPGPPRRSGPAMAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPV
AGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKAKNSSGTSVPPEASSTAAPESSTSF
PLAPASGMSHTPPTVREDRSPSEESVPTASPESVSGSVPSSGSSGREEDAASTLVTGSEY
ETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQTS
TEPAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQM
LNEPPGELADISDIEGEVGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFA
CEKNENLAANFLLSQNFDDE
Download sequence
Identical sequences G1PLA9
ENSMLUP00000011631 ENSMLUP00000011631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]