SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011698 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011698
Domain Number 1 Region: 23-118
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000415
Family SH3-domain 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011698
Domain Number - Region: 645-708
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0222
Family Myosin rod fragments 0.0098
Further Details:      
 
Domain Number - Region: 683-799
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0238
Family Myosin rod fragments 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011698   Gene: ENSMLUG00000012857   Transcript: ENSMLUT00000012860
Sequence length 1306
Comment pep:novel scaffold:Myoluc2.0:GL430035:1135323:1261852:-1 gene:ENSMLUG00000012857 transcript:ENSMLUT00000012860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEIGVHRILVLVISLTKCLEGTKLLANFKKCADVECETLISRVLAMRDYRGPDCLYLNF
TKGEEISVYVKLAGEREDLWAGSKGKDFGYFPRDAVQIEEVFIPEEIQIPTKESDFLCLL
GVSYAFENEDSELNSDGGENIYPHEDDKNQKSSVYNNDFQREPGFYSVSESTCYEDQFPS
SEAPDDIRKTSNSKNWEGVEAGSVKQDPIPEVDYVPPSTAVPEVKGWFGFRREQAEEITF
ESVIEQESSFQSRKIAVEDEKDLEKLNNGGPQTEHKQEHESELSSVPKKQSRASESEHIL
NPQATSWFGGRFTSYLGFGGEETRPELLSQESNLPLQDVPTSISSEEEPTVPCTEILSEK
EDTVTNNSSIIEPSWFDFGFSMLGFAYANEDKTMTYSEKKEEGGKGEKHEHPPTSEFDPD
KKQKIKIIKIMETEDQLGKEGILEKTDDSDTLPYFKHFLHNFDNPWDFQNDENNVFENDE
REEFSFENDPTANTKLMMLKRRYSQSEDASEGHILKFLFQFMNLAFSPIAILTERVVAAL
PEDMREGSNPYGFPWELLVCAVIVGFFAVFLFLWRSFRSVRSRLYVAKFAYLFLILFHLL
IPTQIKFVLFTYSVAFFQYEGLESLKDSSSEKESTEAQNLEAICEKLNSSKSECEDEIDF
LEKELKEEKSKHSEQDELMVDISKRIQSLEDESKSLKSQVAEAKTTFKIFQMNEERLKIA
IKDALSENSQLQESQKQLLQEAEEWKEQVSELNKQKITFEDSRVHAKQVLCDKENQIKSL
TERLLKMQDWAAVLGEDITDDNLELEVKSESENGALSVDNEPKGALRKLIHAAKLKASLK
TLEGERNQIYTQLTEVDKTKEDLTECIKNIQTEQACLQPENEHLENENQKLQHKLKVMTE
LYQENEMTLHRKLTVEENYRLEKEEKLSKADEKISHAAEELETYRKRTKDLEEELERTIR
SYQGQIISHEKKAHDNWLAARTAERNLNDLKKENSYLRQKLTETEIKFELLEKDPYAVDV
PNTAFGREHSPYGPSPLGRPSSETRAFLSPPPLLEGPLRLSPLLPGGGGRGSRGPGNPQD
HLITNERGKSSYDKSADPHREPSDTGSLSPPWEHDRRMMIPSSGQPYSDPALPPQRQDRF
YSNTGRLSGPAELRSFNMPSLDKADGPKSSEMESSGNDSKDDLGNLNVPDASLPTKSEAA
GPGFAPPVRGPLFPMDARGPYLRRGPPFPPLPGSMYGASHDYFPPGDFPGPPPPPFAMRN
VYSPRAFPHYLPPRAGFFPPPPSSHPESRSEVPSGLSPPSNEPTTE
Download sequence
Identical sequences G1PLG4
ENSMLUP00000011698 ENSMLUP00000011698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]