SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011757 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011757
Domain Number 1 Region: 281-346
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.00000302
Family gamma-Butyrobetaine hydroxylase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011757   Gene: ENSMLUG00000012924   Transcript: ENSMLUT00000012925
Sequence length 364
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430247:640959:644186:-1 gene:ENSMLUG00000012924 transcript:ENSMLUT00000012925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKGNSPGGNQGVAMEEELGGQGNWGLEDAPGLLAMASLPIMPTWPLPLVSSAFTLLLGA
LTSLFLWYCYYLGSQDLQALAAGSRAGGVSGGPGGCSEVGRPSPGSSGEAGKGPRTEGLV
SRRLRAYARRYSWAGMGRVRRAAQGGLGPGGGPGVLGIQRPGLLFLPNLPSVPFVPRDAQ
RHDVELLESSFPAILRDFGAVSWDFSGTTPLPRGWSPPLAPGCYQLLLYQAGRCQPNNCR
RCPGAYRALRGLRSFMSANSFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPLGCEL
VVGGEPQCWAEGHCLLVDDSFLHTVAHNGSPEDGPRVVFIVDLWHPNVAGAERQALDFVF
APDP
Download sequence
Identical sequences G1PLL7
ENSMLUP00000011757 ENSMLUP00000011757 XP_006103409.1.53796 XP_006752644.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]