SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011770 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011770
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily UBA-like 1.47e-32
Family UBA domain 0.00000659
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011770   Gene: ENSMLUG00000012931   Transcript: ENSMLUT00000012940
Sequence length 1087
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:512236:556989:-1 gene:ENSMLUG00000012931 transcript:ENSMLUT00000012940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDI
TGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEG
KENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSGGPSGRGTERGRRGRGRG
RGGSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNNSGSTWNNTGHFEPDDGTSAWRTA
TEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENDSS
NLDPSQAPSLAQPLVFSNSKQNTISQPASGNTFSHHSVVSMLGKGFGDVSETKSGSTTGS
QFLEQFKTAQALAQLAAQHSQSGTTTTSSWDMGSTTQSPSLVQYDLKNPNDSTVHSPFTK
RQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQP
AQQKLKQQKKKASLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSA
SSSQAPNSLYTSTASESSSTISSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTR
RYPSSISSSPQKDLTQAKNGFSSVQATQLQTTQSVEGATGSAVKSDSPSTSSIPPLSETV
SAASLLTTTNQHSSTLGGLNHSEEIPNTTTTQHNSTLSTQQNTLSSSTSSGRTSTSTLLH
TSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLNIGSNSTVTASTRSSV
ATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFP
APTTPLTGRDGSLSSNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNP
ALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGY
GSHGYNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPIN
PATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQTGSGQRSQTSSIPQKPQTNKSAYN
SYSWGAN
Download sequence
Identical sequences G1PLM9
XP_005867538.1.60319 XP_006095176.1.53796 XP_014316641.1.53796 ENSMLUP00000011770 ENSMLUP00000011770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]