SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011784 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011784
Domain Number 1 Region: 299-354
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-18
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011784   Gene: ENSMLUG00000012953   Transcript: ENSMLUT00000012955
Sequence length 356
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430021:1344077:1354845:1 gene:ENSMLUG00000012953 transcript:ENSMLUT00000012955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAMAELQQLQEFEIPTGREALRGNHSALLRVADYCEDNYAQATDKRKALEETMAFTTQA
LASVAYQVGNLAGNTLRMLDLQAVALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQR
LHPSQKVIAPESLPPLTPYFRKPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATP
TSATLGRAPRIPEPVQLPVVPDGKLSAASSASSLASAGSAEGVGGASTAKGQAAPPPPPL
PSSMAPPPPPASDIDLLPPPLERTVPAPSSLLPYVLPRIMQAPVSPWLGRRHFSWRPLLR
PAVVTLYPYTGQKDNELSFSEGTVICITRRHSDGWCEGVTSEGTGFFPGNYVAPSC
Download sequence
Identical sequences G1PLP3
ENSMLUP00000011784 ENSMLUP00000011784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]