SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011865 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011865
Domain Number 1 Region: 1264-1398
Classification Level Classification E-value
Superfamily PH domain-like 7.53e-43
Family Phosphotyrosine-binding domain (PTB) 0.000000212
Further Details:      
 
Domain Number 2 Region: 297-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.9e-36
Family PLC-like (P variant) 0.0053
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-26
Family Dual specificity phosphatase-like 0.00024
Further Details:      
 
Domain Number 4 Region: 1111-1254
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 23-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011865   Gene: ENSMLUG00000013033   Transcript: ENSMLUT00000013044
Sequence length 1400
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429927:1603978:1617320:1 gene:ENSMLUG00000013033 transcript:ENSMLUT00000013044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRATNRPRKAEPHSFREKVFRKKPPVCAVCKVTIDGTGVSC
RVCKVATHRKCEAKVTSSCQALPPAELRRSTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEERHRSHLRELAHVLQSKHRDKYLFFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGSKSKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVAAELQPSQRRYISYFSGLLSGSIRMNSS
PLFLHYVLVPVLPAFEPGTGFQPFLKIYQSMQLVYTSGIYHIAGPGPQQLCISLEPALLL
KGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGSRLTFPKDQLDEAWTDERFPFQASVEF
IFSSSPEKIKGNIPRNDPSVTVDYNTAEPAVRWDSYENFNQHHEDSVEGSLTHTRGPLDG
SPYAQVQRAPRQTPPAPSPELPPAPLLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LDRLLGGCGVAGAGRGAGRETAILDDEEQPPASGGAHIGTYSGHRPPLSRHCSCRQGYRE
PCGVPNGGYYQPEGTLERRRLAYGYEGPAQGYAEASVEKRRLCRSLSEGPYPYPPELGKP
TSGDFGYRSPGYREVVILEEPGLPALCSCPACQEKLALPTTALYGLRLEREAGEGWASEA
SKPLLHPVRSGHPLPLLVPACGHHHAPIPDYSCLKPPKAGEEGHEGCSYPMCPEGRYGHP
GYPALVTYGYGGAVPSYCPAYGRVPHSCGSAGEGRGYPSPGAHSPRAGSISPGSPPYPPS
RKLSYEIPAEEGGDRYPLPSHLAPAGPLTSAESPEPASWREGPSRHSTLPRSPRDAPCST
SSEMSGPSTPLHTSSPVQGKESTRRQDTRSPTLAPTQRLSPGEALLPVSQGGAEKPPELP
ARSGLEPPAPSPLSPTSPPSSPNDWPQERSPGGRSDSGSPRGPVPTTLPGLRHAPWQGLR
EPPDSPDGSPLTPVPTQMPWLVASPEPPQSSPTPAFPVAASYDLNGPTQPPLPEKRHLPG
PGQQPGPWGPEQASPPARGTSHHVTFAPQLPDNTPQPPEPPLQESQSNVKFVQDTSKFWY
KPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPLEQLVRH
FLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEETPEIPVPA
NMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALGCSPRPTPAVVHFKVSAQ
GITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKPGSPWENVCHLFAELDP
DQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences G1PLW2
ENSMLUP00000011865 ENSMLUP00000011865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]