SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011881 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011881
Domain Number 1 Region: 441-496
Classification Level Classification E-value
Superfamily UBA-like 0.000000000288
Family UBA domain 0.00017
Further Details:      
 
Domain Number 2 Region: 513-563
Classification Level Classification E-value
Superfamily UBA-like 0.0000544
Family UBA domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011881   Gene: ENSMLUG00000013063   Transcript: ENSMLUT00000013061
Sequence length 567
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430013:833590:871168:-1 gene:ENSMLUG00000013063 transcript:ENSMLUT00000013061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGAVRGRRREVGLQHGGCGTGFGCGDGLAWGGQSGRWWCSLSLEAVSGDRAWEVGGARTF
RLPGRRRQRRQIVGTFSYLDDVPFKIGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSL
ERKTIEWAEDIKKIHEAQREAERKAEEAEAKVNSKSGPEGDNKMSFSKTHSTATMPPPIN
PILATLQHNSILTPTRYSSTMKQKVLSPPHTKADFNPADFECEEDPFDNLELKTIDEKEE
LRNILVGTTGPIMAQLLDSNLPRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQ
LGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQ
NSLKPSTQSSASELSGHQSLGLSTLNLDSGTEVPALTPSDMISQTPSLSVLSVCTEESSP
PNTGSTATPPKFSMSQVPNTPSCPQAYSELQTLSPSERQCVETVVNMGYSYECVLRAMKK
KGENIEQILDYLFVHGQLCEKGFDPLLVEEALEMHQCSEEKMLEFLQLMSKFKEMGFELK
DIKEVLLLHNNDQDNALEDLMARAGAS
Download sequence
Identical sequences G1PLX6
ENSMLUP00000011881 ENSMLUP00000011881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]