SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011918 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011918
Domain Number 1 Region: 12-64
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000394
Family SH3-domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011918
Domain Number - Region: 450-532
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0189
Family PLC-like (P variant) 0.037
Further Details:      
 
Domain Number - Region: 600-664,794-887,941-979
Classification Level Classification E-value
Superfamily ARM repeat 0.0547
Family PBS lyase HEAT-like repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011918   Gene: ENSMLUG00000013075   Transcript: ENSMLUT00000013102
Sequence length 1865
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429785:38347:129155:1 gene:ENSMLUG00000013075 transcript:ENSMLUT00000013102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWIKKKFRKFLAVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSS
YVHLKHAGVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMN
EVLDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITEL
YRLMEHRHRKKDAPAQASSHHLFVQLKSLMCSNLGEELEVVFSLFDSRENRPISERFFLR
LNRNGLPKAPDKPERHCSLFVDLSSGELRRDIYITVHIIRIGRMGAGEKKNACSVQYRRP
FGCAVLSIADLLTGETKDDLILKVYMCNTESEWHQIHENIIKKLNARYNLTGSNAGLAVS
LQLLHGDLEQIRREYPSVFSHGVSITRKLGFSNIIMPGEMRNDLYITVERGEFEKGGKSV
ARNVEVTMFIVESGGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWAELLKLPIPVDKF
RGAHIRFEFRHCSTKEKGEKKLFGFSFIPLMQEDGRTLPDGTHELIVHKCEENTSLQDPT
RYLKLPFSKGLLLGTSSLAPKTTKESFWITSFLCSTKLTQNGDMLDLLKWRTHPDKIPGC
LSKLKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPV
MDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFS
LATGGQHEEEFRCCIRELLLSVRFFLSQESKGAGPLSQSQAVFLSSFPAVYSELLKLFDV
REVANLVQDTLGSLPTLLHVDETLQAVKLQCIGQTVESQLYTNPDSRCILLPVVLHHLHM
HLRQQKDLVACARILSNVFCLSKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQAS
GPATRLHFQDVTTGLCSAGSPRAHGPGRITCKGSSICNHEGPKAVVQSKSLGEFVACLLS
LLRQMTDRHYQQLLDSFSTKEELRDFSGRTLSAKKFCDLPGQAGTFFALSWTQRGRIRRL
MNLKTIVLTAVCMLHQQAESFCRTTLSPKAWPLTCITICIYFQQRFMQPHPVLRKKIDRK
HKDINKRAPMLKLGCKYLCWTRHGEVLAATRAAPRGVHIPFVSICLETPLAQGSRERALL
GVLQVEAKLIDKLDSLMSEGKGDETYRELFNSIIPLFGPYPSLLKKIERETWRESGVSLI
ATVTRLMERLLDYRDCMKVGEVDGKKIGCTVSLLNFYKTELNKEEMYIRYIHKLYDLHLK
AQNFTEAAYTLLLYDELLEWSDRPLREFLSYPAQTEWQREHLHLAIIQNFDRGKCWENGI
VLCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFLRNK
EFVCRGHDYERLEAFQQRMLTEFPHAIAMQHANQPDETIFQAEAQYLQIYAVTPIPESQE
VLQRDGVPDNIKSFYKVNRIWKFRYDRPFHKGPKDKENEFKSLWVERTSLFLVQSLPGIS
RWFEVDKREVVEMTPLENAIEVLENKNQQLKTLISQCRTRQMQNINPLTMCLNGVIDAAV
NGGVSRYQEAFFVKEYILSHPEDGEKIARLQELMLEQAQILECGLAVHEKFVPQDMRPLH
KKLVDQFFMMKSSLGIQEFSACIQASPVHFPNGSPRVCRNSAPASMSPDGSRVIPRRSPL
SYPAINRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLSSTHSASPNVTSSA
PSSARASPLLSDKHKHSRENACLSPRERPCSAIYPTPVEPSQRLLFNHIGDGAMPRSDPN
LSAPEKAVNPTPSSWSLDSGKEARSMAESGRLLSPPVPPRPALTASPARHTAPVSPSPAG
RSPLK
Download sequence
Identical sequences G1PM09
ENSMLUP00000011918 ENSMLUP00000011918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]