SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011919 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011919
Domain Number 1 Region: 28-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-31
Family Ribonuclease PH domain 1-like 0.000000506
Further Details:      
 
Domain Number 2 Region: 147-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.15e-23
Family Ribonuclease PH domain 2-like 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011919   Gene: ENSMLUG00000013104   Transcript: ENSMLUT00000013103
Sequence length 235
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430188:666264:675075:-1 gene:ENSMLUG00000013104 transcript:ENSMLUT00000013103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERAMQSEAKSHTEHGTDSSPQGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYG
PAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGALHPRTSITIVL
QVISDAGSLMACCLNAACMALVDAGVPMQALFCGVTCALDSDGTLVLDPTAKQEKEARAV
LTFALDSVDQKLLMSTTKGLYSNAELQQCLAAAQAASQHVFRFYRESLQRRYSKS
Download sequence
Identical sequences G1PM10
ENSMLUP00000011919 ENSMLUP00000011919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]