SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011946 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011946
Domain Number 1 Region: 14-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.51e-44
Family FCH domain 0.0055
Further Details:      
 
Domain Number 2 Region: 438-497
Classification Level Classification E-value
Superfamily SH3-domain 1.19e-22
Family SH3-domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011946
Domain Number - Region: 301-366
Classification Level Classification E-value
Superfamily HR1 repeat 0.000759
Family HR1 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011946   Gene: ENSMLUG00000013124   Transcript: ENSMLUT00000013132
Sequence length 505
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:12355497:12402826:-1 gene:ENSMLUG00000013124 transcript:ENSMLUT00000013132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPNSPTLCEYNQVYKSLKEFSQNGENFCKQVTSILQQRANLEFNYAKGLQKQAIKLNKAL
QNTKKNCVASAWAWVSEGMKSAADLHQKLGKAIELEAVKPTYQVLSVHEKKRKSLDNEVE
KTANLFISNWNQQIKAKKKLMESTKKHEALFHLIESSKQTMTDKEKQKLLNKLKKSTEKL
TKEDENYYQKNMAGCSTRLKWENTLENCYQNILELEKERIKLLCNNLNQYTQHISVFGQT
LTTCHMHIHGAISKIDVEKDIQALMEETAISSTENKSEFLLTDYFEEDPNNAMNKERQKS
SIKSKLLRLQRDIEKASSDREGLRRMLKAYSNNSFSDPESQKSTAALMEETILKLDLMQA
NAYKLSSVLAELEQRPQPSHPCSNSIFKRKEKQQTHSYVRISRPFLMKRLQTVVRRTSPG
GQSNPSSSCAASGVAQHGNILCKALYSFQARQDDELDLEVGDIVTIHRKQEEGWWFGSLN
GKKGHFPAAYVQELPSDAGYTGMKQ
Download sequence
Identical sequences G1PM35
ENSMLUP00000011946 ENSMLUP00000011946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]