SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011954 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011954
Domain Number 1 Region: 427-623
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.06e-47
Family cAMP-binding domain 0.0000885
Further Details:      
 
Domain Number 2 Region: 181-426
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-34
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011954   Gene: ENSMLUG00000013140   Transcript: ENSMLUT00000013140
Sequence length 707
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429977:472927:499111:1 gene:ENSMLUG00000013140 transcript:ENSMLUT00000013140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKINTQYSHPNPPGPWVRATDSDLDHLENGLSRMGLPPSLPSGLRPRGVWLQEKGPGKE
RQNVCTSLGENRLWRLIVSLRIWASRHAHHRDQRPDAFLERFRGAELKEVSSRESNARSQ
GGQEPADSERRRLSSWWLGPARSNANTCSSSEKRDKARKEKEEREEGKLPQTREKDAVVL
DPSSNVYYRGLTVIALPVLYNWCLLVCRACFDELQSEHLVLWLVLDYSADVLYGLDVLVR
ARTGFLEQGLMVRDAKRLWRHYTETLQFKLDVLSLVPTDLAYFKLGINYPELRFNRLLKF
ARLFEFFDRTETRTSYPNVFRIGNLVLYILVIIHWNACIYFAISKFIGFGTDSWVYPNIS
NPEYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGS
MISNMNASRTEFQAKIDSIKQYMQLRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKSLP
DKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYI
IKEGKLAVVADDGLTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSK
DDLMEALTEYPDAKKALEEKGRQILMKDNLIDEDLAKAGADPQDIEEKVEHLESSLDTLQ
TRFARLLAEYSASQMAVKQRLSQLESQVQLCGRSPLPEGVAPEPETK
Download sequence
Identical sequences G1PM42
ENSMLUP00000011954 ENSMLUP00000011954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]