SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011990 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011990
Domain Number 1 Region: 261-306
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000386
Family HtrA-like serine proteases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011990   Gene: ENSMLUG00000013179   Transcript: ENSMLUT00000013181
Sequence length 526
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429787:614565:669996:1 gene:ENSMLUG00000013179 transcript:ENSMLUT00000013181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPVSLVVVVVGGWTAVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTAVFNRA
FYSWGRRKARMLYQWFNFGMVFGVIAMFSSFFLLGKTLMQTLAQMMADSSTSYSSSSSSS
SSSSSSSSSSSSSSSSSSSSSSSLHNEQVLQVVVPGINLPVNQLTYFFAAVLISGVVHEI
GHGIAAIREQVRFNGFGIFLFIIYPGAFVDLFTTHLQLISPVQQLRIFCAGIWHNFVLAL
LGILALVLLPVILLPFYYTGVGVLITEVAEDSPAVGPRGLFVGDLVTHLQDCPVTNVQDW
NECLDTIAYEPQIGYCISAATLQQLSFPVRAYKRLDGSIECCNNQSLTDVCFSYRNNFNK
RLHTCLPARKAVEATQVCRTNKDCKRGSSSSFCIIPSLETHTRLIKVKHPPQIDMLYVGH
PLHLHYTVSITSFIPRFNFLSIDLPVVVETFVKYLISLSGALAIVNAVPCFALDGQWILN
SFLDATLTSVIGDNDVKDLIGFFILLGGSILLAANVTLGLWMVTAR
Download sequence
Identical sequences G1PM74
ENSMLUP00000011990 ENSMLUP00000011990 XP_006085678.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]